PDB entry 1ht9

View 1ht9 on RCSB PDB site
Description: domain swapping ef-hands
Class: metal binding protein
Keywords: domain swapping, calbindin d9k, ef-hand, calcium binding, folding, metal binding protein
Deposited on 2000-12-29, released 2001-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.162
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (1-75)
      • cloning artifact (0)
      • engineered (22)
      • engineered (43)
    Domains in SCOPe 2.06: d1ht9a1, d1ht9a2
  • Chain 'B':
    Compound: calbindin d9k
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (1-75)
      • cloning artifact (0)
      • engineered (22)
      • engineered (43)
    Domains in SCOPe 2.06: d1ht9b1, d1ht9b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ht9A (A:)
    mkspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdg
    evsfeefqvlvkkisq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ht9B (B:)
    mkspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdg
    evsfeefqvlvkkisq