PDB entry 1ht9

View 1ht9 on RCSB PDB site
Description: domain swapping ef-hands
Deposited on 2000-12-29, released 2001-05-09
The last revision prior to the SCOP 1.61 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.162
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ht9a_
  • Chain 'B':
    Domains in SCOP 1.61: d1ht9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ht9A (A:)
mkspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdg
evsfeefqvlvkkisq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ht9B (B:)
mkspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdg
evsfeefqvlvkkisq