PDB entry 1ht2

View 1ht2 on RCSB PDB site
Description: Nucleotide-Dependent Conformational Changes in a Protease-Associated ATPase HslU
Class: chaperone
Keywords: hslvu, peptidase-ATPase complex
Deposited on 2000-12-27, released 2001-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.262
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2a_
  • Chain 'B':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2b_
  • Chain 'C':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2c_
  • Chain 'D':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2d_
  • Chain 'E':
    Compound: heat shock locus hslu
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • his tag (6)
    Domains in SCOP 1.75: d1ht2e_
  • Chain 'F':
    Compound: heat shock locus hslu
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • his tag (6)
    Domains in SCOP 1.75: d1ht2f_
  • Chain 'G':
    Compound: heat shock locus hslu
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • his tag (6)
    Domains in SCOP 1.75: d1ht2g_
  • Chain 'H':
    Compound: heat shock locus hslu
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • his tag (6)
    Domains in SCOP 1.75: d1ht2h_
  • Chain 'I':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2i_
  • Chain 'J':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2j_
  • Chain 'K':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2k_
  • Chain 'L':
    Compound: heat shock locus hslv
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ht2l_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ht2A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ht2B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ht2C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ht2D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ht2E (E:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2E (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ht2F (F:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2F (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ht2G (G:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2G (G:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ht2H (H:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2H (H:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ht2I (I:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2I (I:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ht2J (J:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2J (J:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ht2K (K:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2K (K:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ht2L (L:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht2L (L:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk