PDB entry 1ht1

View 1ht1 on RCSB PDB site
Description: Nucleotide-Dependent Conformational Changes in a Protease-Associated ATPase HslU
Class: chaperone
Keywords: hslvu, peptidase-ATPase complex, chaperone
Deposited on 2000-12-27, released 2001-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.261
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1a_
  • Chain 'B':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1b_
  • Chain 'C':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1c_
  • Chain 'D':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1d_
  • Chain 'E':
    Compound: heat shock locus hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • expression tag (6)
    Domains in SCOPe 2.06: d1ht1e1, d1ht1e2
  • Chain 'F':
    Compound: heat shock locus hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • expression tag (6)
    Domains in SCOPe 2.06: d1ht1f1, d1ht1f2
  • Chain 'G':
    Compound: heat shock locus hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • expression tag (6)
    Domains in SCOPe 2.06: d1ht1g1, d1ht1g2
  • Chain 'I':
    Compound: heat shock locus hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • expression tag (6)
    Domains in SCOPe 2.06: d1ht1i1, d1ht1i2
  • Chain 'V':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1v_
  • Chain 'X':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1x_
  • Chain 'Y':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1y_
  • Chain 'Z':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ht1z_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ht1A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1A (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ht1B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1B (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ht1C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1C (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ht1D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1D (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ht1E (E:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1E (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ht1F (F:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1F (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ht1G (G:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1G (G:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ht1I (I:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1I (I:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1ht1V (V:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1V (V:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ht1X (X:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1X (X:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1ht1Y (Y:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1Y (Y:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1ht1Z (Z:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ht1Z (Z:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk