PDB entry 1ht0

View 1ht0 on RCSB PDB site
Description: human gamma-2 alcohol dehydrogense
Class: oxidoreductase
Keywords: rossmann fold, alcohol dehydrogenase, zinc, OXIDOREDUCTASE
Deposited on 2000-12-27, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I alcohol dehydrogenase 3, gamma subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH3 OR ADH1C*2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00326 (0-373)
      • polymorphic variant (270)
      • polymorphic variant (348)
    Domains in SCOPe 2.07: d1ht0a1, d1ht0a2
  • Chain 'B':
    Compound: class I alcohol dehydrogenase 3, gamma subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH3 OR ADH1C*2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00326 (0-373)
      • polymorphic variant (270)
      • polymorphic variant (348)
    Domains in SCOPe 2.07: d1ht0b1, d1ht0b2
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ht0A (A:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
    gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavkvakvtpgstcavfglggvglsvvmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigqldtmmasllccheacgtsvivgvppdsqn
    lsinpmllltgrtwkgaifggfkskesvpklvadfmakkfsldalitnvlpfekinegfd
    llrsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ht0B (B:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvaagicrsdehvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcricknpesnyclkndlgnpr
    gtlqdgtrrftcsgkpihhfvgvstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavkvakvtpgstcavfglggvglsvvmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigqldtmmasllccheacgtsvivgvppdsqn
    lsinpmllltgrtwkgaifggfkskesvpklvadfmakkfsldalitnvlpfekinegfd
    llrsgksirtvltf