PDB entry 1hsz

View 1hsz on RCSB PDB site
Description: human beta-1 alcohol dehydrogenase (adh1b*1)
Class: oxidoreductase
Keywords: rossmann fold, alcohol dehydrogenase, zinc, OXIDOREDUCTASE
Deposited on 2000-12-27, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I alcohol dehydrogenase 1, beta subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH2 OR ADH1B*1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hsza1, d1hsza2
  • Chain 'B':
    Compound: class I alcohol dehydrogenase 1, beta subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH2 OR ADH1B*1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hszb1, d1hszb2
  • Heterogens: ZN, PO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hszA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hszB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf