PDB entry 1hsz

View 1hsz on RCSB PDB site
Description: human beta-1 alcohol dehydrogenase (adh1b*1)
Deposited on 2000-12-27, released 2001-01-10
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hszA (A:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hszB (B:)
    stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
    lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
    gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppasqn
    lsinpmllltgrtwkgavyggfkskegipklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtvltf