PDB entry 1hsy

View 1hsy on RCSB PDB site
Description: origin of the ph-dependent spectroscopic properties of pentacoordinate metmyoglobin variants
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1994-12-12, released 1995-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-27, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-152)
    • conflict (63)
  Domains in SCOP 1.73: d1hsya_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hsyA (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkktgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfqg