PDB entry 1hss

View 1hss on RCSB PDB site
Description: 0.19 alpha-amylase inhibitor from wheat
Class: cereal inhibitor
Keywords: cereal inhibitor, animal amylase
Deposited on 1997-07-01, released 1998-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.187
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 0.19 alpha-amylase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hssa_
  • Chain 'B':
    Compound: 0.19 alpha-amylase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hssb_
  • Chain 'C':
    Compound: 0.19 alpha-amylase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hssc_
  • Chain 'D':
    Compound: 0.19 alpha-amylase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hssd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hssA (A:)
    sgpwmcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysm
    ldsmykehgaqegqagtgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaa
    ypda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hssA (A:)
    mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
    ykehgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hssB (B:)
    sgpwmcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysm
    ldsmykehgaqegqagtgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaa
    ypda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hssB (B:)
    mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
    ykehgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hssC (C:)
    sgpwmcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysm
    ldsmykehgaqegqagtgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaa
    ypda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hssC (C:)
    mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
    ykehgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hssD (D:)
    sgpwmcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysm
    ldsmykehgaqegqagtgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaa
    ypda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hssD (D:)
    mcypgqafqvpalpacrpllrlqcngsqvpeavlrdccqqlahisewcrcgalysmldsm
    ykehgafprcrrevvkltaasitavcrlpivvdasgdgayvckdvaaypda