PDB entry 1hso

View 1hso on RCSB PDB site
Description: human alpha alcohol dehydrogenase (adh1a)
Class: oxidoreductase
Keywords: rossmann fold, alcohol dehydrogenase, OXIDOREDUCTASE
Deposited on 2000-12-27, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.248
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I alcohol dehydrogenase 1, alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hsoa1, d1hsoa2
  • Chain 'B':
    Compound: class I alcohol dehydrogenase 1, alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hsob1, d1hsob2
  • Heterogens: ZN, NAD, PYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsoA (A:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvavgicgtddhvvsgtmvtp
    lpvilgheaagivesvgegvttvkpgdkviplaipqcgkcricknpesnyclkndvsnpq
    gtlqdgtsrftcrrkpihhflgistfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsaimgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppdsqn
    lsmnpmllltgrtwkgailggfkskecvpklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtilmf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsoB (B:)
    stagkvikckaavlwelkkpfsieevevappkahevrikmvavgicgtddhvvsgtmvtp
    lpvilgheaagivesvgegvttvkpgdkviplaipqcgkcricknpesnyclkndvsnpq
    gtlqdgtsrftcrrkpihhflgistfsqytvvdenavakidaasplekvcligcgfstgy
    gsavnvakvtpgstcavfglggvglsaimgckaagaariiavdinkdkfakakelgatec
    inpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgvppdsqn
    lsmnpmllltgrtwkgailggfkskecvpklvadfmakkfsldalithvlpfekinegfd
    llhsgksirtilmf