PDB entry 1hsn

View 1hsn on RCSB PDB site
Description: the structure of the hmg box and its interaction with dna
Deposited on 1994-11-17, released 1995-02-07
The last revision prior to the SCOP 1.69 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1hsn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hsn_ (-)
  napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
  ekyekdiaayrakgkpdaa