PDB entry 1hsm

View 1hsm on RCSB PDB site
Description: the structure of the hmg box and its interaction with dna
Deposited on 1994-11-17, released 1995-02-07
The last revision prior to the SCOP 1.65 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1hsm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsm_ (-)
    napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
    ekyekdiaayrakgkpdaa