PDB entry 1hrq

View 1hrq on RCSB PDB site
Description: the three-dimensional solution structure of the reduced high-potential iron-sulfur protein from chromatium vinosum through nmr
Deposited on 1995-01-17, released 1995-06-03
The last revision prior to the SCOP 1.55 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1hrq__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hrq_ (-)
  sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
  kgcqlfpgklinvngwcaswtlkag