PDB entry 1hro

View 1hro on RCSB PDB site
Description: molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis
Deposited on 1996-07-10, released 1997-01-11
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hroa_
  • Chain 'B':
    Domains in SCOP 1.57: d1hrob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hroA (A:)
    sappgdpvegkhlfhticitchtdikgankvgpslygvvgrhsgiepgynyseaniksgi
    vwtpdvlfkyiehpqkivpgtkmgypgqpdpqkradiiayletlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hroB (B:)
    sappgdpvegkhlfhticitchtdikgankvgpslygvvgrhsgiepgynyseaniksgi
    vwtpdvlfkyiehpqkivpgtkmgypgqpdpqkradiiayletlk