PDB entry 1hrk

View 1hrk on RCSB PDB site
Description: crystal structure of human ferrochelatase
Class: lyase
Keywords: ferrochelatase, Fe2S2 Cluster, heme biosynthesis, PROTOHEME FERRO-LYASE, mature length, proteolytically processed mitochondrial inner membrane protein
Deposited on 2000-12-21, released 2001-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22830 (0-358)
      • engineered (31)
      • engineered (50)
    Domains in SCOPe 2.05: d1hrka_
  • Chain 'B':
    Compound: Ferrochelatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22830 (0-358)
      • engineered (31)
      • engineered (50)
    Domains in SCOPe 2.05: d1hrkb_
  • Heterogens: CHD, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrkA (A:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrkB (B:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrltpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql