PDB entry 1hrb

View 1hrb on RCSB PDB site
Description: atomic models for the polypeptide backbones of myohemerythrin and hemerythrin
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1976-06-23, released 1978-09-28
The last revision prior to the SCOP 1.75 freeze date was dated 1983-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 5.5 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemerythrin b
  Species: Phascolopsis gouldii
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02244 (0-112)
    • conflict (57-58)
    • conflict (62)
    • conflict (77)
    • conflict (81)
    • conflict (95)
  Domains in SCOP 1.75: d1hrba_
• Chain 'B':
  Compound: hemerythrin b
  Species: Phascolopsis gouldii
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02244 (0-112)
    • conflict (57-58)
    • conflict (62)
    • conflict (77)
    • conflict (81)
    • conflict (95)
  Domains in SCOP 1.75: d1hrbb_
• Heterogens: FE

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hrbA (A:)
  gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
  lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hrbB (B:)
  gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
  lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki