PDB entry 1hrb

View 1hrb on RCSB PDB site
Description: atomic models for the polypeptide backbones of myohemerythrin and hemerythrin
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1976-06-23, released 1978-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 5.5 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemerythrin b
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (0-112)
      • conflict (57-58)
      • conflict (62)
      • conflict (77)
      • conflict (81)
      • conflict (95)
    Domains in SCOPe 2.08: d1hrba_
  • Chain 'B':
    Compound: hemerythrin b
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (0-112)
      • conflict (57-58)
      • conflict (62)
      • conflict (77)
      • conflict (81)
      • conflict (95)
    Domains in SCOPe 2.08: d1hrbb_
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrbA (A:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
    lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrbB (B:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
    lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki