PDB entry 1hra

View 1hra on RCSB PDB site
Description: the solution structure of the human retinoic acid receptor-beta DNA-binding domain
Class: DNA-binding receptor
Keywords: DNA-binding receptor
Deposited on 1993-07-25, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoic acid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hraa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hraA (A:)
    mprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
    qycrlqkcfevgmskesvrn