PDB entry 1hra

View 1hra on RCSB PDB site
Description: the solution structure of the human retinoic acid receptor-beta dna- binding domain
Deposited on 1993-07-25, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1hra__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1hra_ (-)
pprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
qycrlqkcfevgmskesvrn

    Sequence, based on observed residues (ATOM records): (download) 
    >1hra_ (-)
mprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
qycrlqkcfevgmskesvrn