PDB entry 1hr9

View 1hr9 on RCSB PDB site
Description: Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Malate Dehydrogenase Signal Peptide
Deposited on 2000-12-21, released 2001-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hr9A (A:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgnsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr9A (A:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllgggggpgkgmysrlythvlnqyyfvencva
    fnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssl
    lmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagng
    kgratvvmqgdrgsfgdvenvlkayglgnsss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hr9B (B:)
    pgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtqnr
    pqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaiere
    rdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitkny
    kgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfikentl
    ptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngslansy
    msfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaqlkaa
    lllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpvsmva
    lgntstvpnvsyieeklnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hr9C (C:)
    tdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkstehv
    egramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelqeq
    klsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnkfy
    tpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnlpe
    lfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfven
    cvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlk
    ssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnna
    gngkgratvvmqgdrgsfgdvenvlkayglgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr9C (C:)
    tdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkstehv
    egramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelqeq
    klsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnkfy
    tpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnlpe
    lfhiqigfeglpidhpdiyalatlqtllggggspgkgmysrlythvlnqyyfvencvafn
    hsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssllm
    nlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagngkg
    ratvvmqgdrgsfgdvenvlkayglgns
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hr9D (D:)
    qipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtq
    nrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaie
    rerdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitk
    nykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfiken
    tlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngslan
    symsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaqlk
    aalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpvsm
    valgntstvpnvsyieeklnq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hr9E (E:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr9E (E:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsmysrlythvlnqyyfvencvafnhs
    ysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssllmnl
    esklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagngkgra
    tvvmqgdrgsfgdvenvlkayglgns
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hr9F (F:)
    asqipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkg
    tqnrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsa
    iererdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyi
    tknykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfik
    entlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngsl
    ansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaq
    lkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpv
    smvalgntstvpnvsyieeklnq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hr9G (G:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr9G (G:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsgpgkgmysrlythvlnqyyfvencv
    afnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkss
    llmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagn
    gkgratvvmqgdrgsfgdvenvlkayglgns
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hr9H (H:)
    ipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtqn
    rpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaier
    erdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitkn
    ykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfikent
    lptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngslans
    ymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaqlka
    alllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpvsmv
    algntstvpnvsyieeklnq