PDB entry 1hr8

View 1hr8 on RCSB PDB site
Description: Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C Oxidase IV Signal Peptide
Class: hydrolase
Keywords: HxxEH zinc-binding motif, HYDROLASE
Deposited on 2000-12-21, released 2001-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial processing peptidase alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11914 (0-End)
      • see remark 999 (163)
      • see remark 999 (203)
    Domains in SCOPe 2.06: d1hr8a1, d1hr8a2
  • Chain 'B':
    Compound: mitochondrial processing peptidase beta subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10507 (Start-442)
      • engineered (53)
      • see remark 999 (64)
      • see remark 999 (330)
    Domains in SCOPe 2.06: d1hr8b1, d1hr8b2
  • Chain 'C':
    Compound: mitochondrial processing peptidase alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11914
      • see remark 999 (163)
      • see remark 999 (203)
    Domains in SCOPe 2.06: d1hr8c1, d1hr8c2
  • Chain 'D':
    Compound: mitochondrial processing peptidase beta subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10507 (1-442)
      • cloning artifact (0)
      • engineered (53)
      • see remark 999 (64)
      • see remark 999 (330)
    Domains in SCOPe 2.06: d1hr8d1, d1hr8d2, d1hr8d3
  • Chain 'E':
    Compound: mitochondrial processing peptidase alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11914 (0-End)
      • see remark 999 (163)
      • see remark 999 (203)
    Domains in SCOPe 2.06: d1hr8e1, d1hr8e2
  • Chain 'F':
    Compound: mitochondrial processing peptidase beta subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10507 (1-442)
      • cloning artifact (0)
      • engineered (53)
      • see remark 999 (64)
      • see remark 999 (330)
    Domains in SCOPe 2.06: d1hr8f1, d1hr8f2, d1hr8f3
  • Chain 'G':
    Compound: mitochondrial processing peptidase alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11914 (0-End)
      • see remark 999 (163)
      • see remark 999 (203)
    Domains in SCOPe 2.06: d1hr8g1, d1hr8g2
  • Chain 'H':
    Compound: mitochondrial processing peptidase beta subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10507 (Start-442)
      • engineered (53)
      • see remark 999 (64)
      • see remark 999 (330)
    Domains in SCOPe 2.06: d1hr8h1, d1hr8h2
  • Chain 'O':
    Compound: cytochrome c oxidase polypeptide IV
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: cytochrome c oxidase polypeptide IV
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: cytochrome c oxidase polypeptide IV
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: cytochrome c oxidase polypeptide IV
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hr8A (A:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgnsssskndspkkkgwfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr8A (A:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllgggggpgkgmysrlythvlnqyyfvencva
    fnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssl
    lmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagng
    kgratvvmqgdrgsfgdvenvlkayglgnsss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hr8B (B:)
    asqipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkg
    tqnrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsa
    iererdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyi
    tknykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfik
    entlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngsl
    ansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaq
    lkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpv
    smvalgntstvpnvsyieeklnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr8B (B:)
    pgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtqnr
    pqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaiere
    rdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitkny
    kgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfikentl
    ptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngslansy
    msfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaqlkaa
    lllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpvsmva
    lgntstvpnvsyieeklnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hr8C (C:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgnsssskndspkkkgwfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr8C (C:)
    tdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkstehv
    egramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelqeq
    klsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnkfy
    tpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnlpe
    lfhiqigfeglpidhpdiyalatlqtllgggggpgkgmysrlythvlnqyyfvencvafn
    hsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssllm
    nlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagngkg
    ratvvmqgdrgsfgdvenvlkayglgns
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hr8D (D:)
    asqipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkg
    tqnrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsa
    iererdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyi
    tknykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfik
    entlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngsl
    ansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaq
    lkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpv
    smvalgntstvpnvsyieeklnq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hr8E (E:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgnsssskndspkkkgwfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr8E (E:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggmysrlythvlnqyyfvencvafnhsy
    sdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssllmnle
    sklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagngkgrat
    vvmqgdrgsfgdvenvlkayglgns
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hr8F (F:)
    asqipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkg
    tqnrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsa
    iererdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyi
    tknykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfik
    entlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngsl
    ansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaq
    lkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpv
    smvalgntstvpnvsyieeklnq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hr8G (G:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllggggsfsaggpgkgmysrlythvlnqyyfv
    encvafnhsysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknq
    lkssllmnlesklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvn
    nagngkgratvvmqgdrgsfgdvenvlkayglgnsssskndspkkkgwfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr8G (G:)
    artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
    hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
    eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
    fytpentvaafvgvphekaleltgkylgdwqsthppitkkvaqytggescippapvfgnl
    pelfhiqigfeglpidhpdiyalatlqtllgggggmysrlythvlnqyyfvencvafnhs
    ysdsgifgislscipqaapqaveviaqqmyntfankdlrltedevsraknqlkssllmnl
    esklveledmgrqvlmhgrkipvnemiskiedlkpddisrvaemiftgnvnnagngkgra
    tvvmqgdrgsfgdvenvlkayglgnsss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1hr8H (H:)
    asqipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkg
    tqnrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsa
    iererdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyi
    tknykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfik
    entlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngsl
    ansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaq
    lkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpv
    smvalgntstvpnvsyieeklnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hr8H (H:)
    qipgtrtsklpngltiateyipntssatvgifvdagsraenvknngtahflqhlafkgtq
    nrpqqgieleienigshlnaytsrentvyyakslqedipkavdilsdiltksvldnsaie
    rerdviireseevdkmydevvfdhlheitykdqplgrtilgpikniksitrtdlkdyitk
    nykgdrmvlagagavdheklvqyaqkyfghvpksespvplgsprgplpvfcrgerfiken
    tlptthiaialegvswsapdyfvalatqaivgnwdraigtgtnspsplavaasqngslan
    symsfstsyadsglwgmyivtdsnehnvrlivneilkewkriksgkisdaevnrakaqlk
    aalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkddiimwanyrlqnkpvsm
    valgntstvpnvsyieeklnq
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.