PDB entry 1hqy

View 1hqy on RCSB PDB site
Description: Nucleotide-Dependent Conformational Changes in a Protease-Associated ATPase HslU
Class: chaperone
Keywords: hslvu, peptidase-ATPase complex, chaperone
Deposited on 2000-12-20, released 2001-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.287
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hqya_
  • Chain 'B':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hqyb_
  • Chain 'C':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hqyc_
  • Chain 'D':
    Compound: heat shock locus hslv
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hqyd_
  • Chain 'E':
    Compound: heat shock locus hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • expression tag (6)
    Domains in SCOPe 2.06: d1hqye1, d1hqye2
  • Chain 'F':
    Compound: heat shock locus hslu
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6H5 (7-448)
      • expression tag (6)
    Domains in SCOPe 2.06: d1hqyf1, d1hqyf2
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqyA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hqyB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hqyC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hqyD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hqyE (E:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyE (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hqyF (F:)
    hhhhhhhsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknil
    migptgvgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvq
    aieknryraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeie
    idlaaapmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklv
    npeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkh
    gmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvq
    ykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdls
    gqnitidadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyF (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil