PDB entry 1hqy

View 1hqy on RCSB PDB site
Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
Deposited on 2000-12-20, released 2001-11-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-14, with a file datestamp of 2001-11-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.287
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hqya_
  • Chain 'B':
    Domains in SCOP 1.59: d1hqyb_
  • Chain 'C':
    Domains in SCOP 1.59: d1hqyc_
  • Chain 'D':
    Domains in SCOP 1.59: d1hqyd_
  • Chain 'E':
    Domains in SCOP 1.59: d1hqye_
  • Chain 'F':
    Domains in SCOP 1.59: d1hqyf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqyA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqyB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqyC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqyD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hqyE (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyE (E:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hqyF (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqyF (F:)
    hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil