PDB entry 1hqs

View 1hqs on RCSB PDB site
Description: crystal structure of isocitrate dehydrogenase from bacillus subtilis
Deposited on 2000-12-19, released 2001-07-25
The last revision prior to the SCOP 1.69 freeze date was dated 2001-07-25, with a file datestamp of 2001-07-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.202
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1hqsa_
  • Chain 'B':
    Domains in SCOP 1.69: d1hqsb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqsA (A:)
    maqgekitvsngvlnvpnnpiipfiegdgtgpdiwnaaskvleaavekaykgekkitwke
    vyagekaynktgewlpaetldvireyfiaikgplttpvgggirslnvalrqeldlfvclr
    pvryftgvpspvkrpedtdmvifrentediyagieyakgseevqklisflqnelnvnkir
    fpetsgigikpvseegtsrlvraaidyaiehgrksvtlvhkgnimkftegafknwgyela
    ekeygdkvftwaqydriaeeqgkdaankaqseaeaagkiiikdsiadiflqqiltrpnef
    dvvatmnlngdyisdalaaqvggigiapganinyetghaifeathgtapkyagldkvnps
    svilsgvlllehlgwneaadlviksmektiaskvvtydfarlmdgatevkcsefgeelik
    nmd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqsB (B:)
    maqgekitvsngvlnvpnnpiipfiegdgtgpdiwnaaskvleaavekaykgekkitwke
    vyagekaynktgewlpaetldvireyfiaikgplttpvgggirslnvalrqeldlfvclr
    pvryftgvpspvkrpedtdmvifrentediyagieyakgseevqklisflqnelnvnkir
    fpetsgigikpvseegtsrlvraaidyaiehgrksvtlvhkgnimkftegafknwgyela
    ekeygdkvftwaqydriaeeqgkdaankaqseaeaagkiiikdsiadiflqqiltrpnef
    dvvatmnlngdyisdalaaqvggigiapganinyetghaifeathgtapkyagldkvnps
    svilsgvlllehlgwneaadlviksmektiaskvvtydfarlmdgatevkcsefgeelik
    nmd