PDB entry 1hqr

View 1hqr on RCSB PDB site
Description:
Deposited on 2000-12-19, released 2001-01-03
The last revision prior to the SCOP 1.63 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.224
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hqra1, d1hqra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hqrb1, d1hqrb2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hqrd1, d1hqrd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqrA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqrA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvtgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hqrB (B:)
    dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
    nsqkdfledrraavdtycrhnygvgesftvqrrvepkvtvypartqtlqhhnllvcsvng
    fypgsievrwfrnsqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvt
    spltvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqrB (B:)
    dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
    nsqkdfledrraavdtycrhnygvgesftvqrrvepkvtvypahnllvcsvngfypgsie
    vrwfrnsqeekagvvstgliqngdwtfqtlvmletvprevytcqvehpsvtspltvewra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqrD (D:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnkiil
    ekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrs
    difakykdnriinmknfshfdiylek