PDB entry 1hqp

View 1hqp on RCSB PDB site
Description: crystal structure of a truncated form of porcine odorant-binding protein
Class: signaling protein
Keywords: lipocalin, dimer, ligand-binding site, access to the binding site, SIGNALING PROTEIN
Deposited on 2000-12-19, released 2001-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hqpa_
  • Heterogens: PRZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqpA (A:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqpA (A:)
    pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
    igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
    lekfkevtrengipeenivniierddcpa