PDB entry 1hqo

View 1hqo on RCSB PDB site
Description: crystal structure of the nitrogen regulation fragment of the yeast prion protein ure2p
Class: signaling protein
Keywords: glutathione S-transferase superfamily fold, SIGNALING PROTEIN
Deposited on 2000-12-18, released 2001-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: URE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23202 (Start-257)
      • modified residue (76)
      • modified residue (129)
      • modified residue (164)
      • modified residue (175)
      • modified residue (244-245)
    Domains in SCOPe 2.07: d1hqoa1, d1hqoa2
  • Chain 'B':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: URE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23202 (Start-257)
      • modified residue (76)
      • modified residue (129)
      • modified residue (164)
      • modified residue (175)
      • modified residue (244-245)
    Domains in SCOPe 2.07: d1hqob1, d1hqob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqoA (A:)
    veysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapef
    vsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawl
    ffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmeldt
    enaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpevyk
    wtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqoA (A:)
    fqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsvnpnarv
    palidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffqtsghap
    migqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmfdypvwlvgdklt
    iadlafvpwnnvvdriginikiefpevykwtkhmmrrpavikalrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hqoB (B:)
    veysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapef
    vsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawl
    ffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmeldt
    enaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpevyk
    wtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqoB (B:)
    plegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsvnpnarvpali
    dhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffqtsghapmigq
    alhfryfhsqkiasaverytdevrrvygvvemalaerrealvmfdypvwlvgdkltiadl
    afvpwnnvvdriginikiefpevykwtkhmmrrpavikalrge