PDB entry 1hqn

View 1hqn on RCSB PDB site
Description: the selenomethionine derivative of p3, the major coat protein of the lipid-containing bacteriophage prd1.
Deposited on 2000-12-18, released 2001-01-17
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-28, with a file datestamp of 2001-12-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqnA (A:)
    rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa
    itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt
    dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle
    fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplidls
    tlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfsd
    trkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarllm
    gyeyftsrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqnB (B:)
    lrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvta
    aitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmv
    tdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkl
    efannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplidl
    stlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfs
    dtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarll
    mgyeyftsrt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hqnC (C:)
    alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
    aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
    vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
    lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid
    lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf
    sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl
    lmgyeyftsrte