PDB entry 1hqm

View 1hqm on RCSB PDB site
Description: crystal structure of thermus aquaticus core RNA polymerase-includes complete structure with side-chains (except for disordered regions)-further refined from original deposition-contains additional sequence information
Class: transferase
Keywords: Transferase, DNA-directed RNA polymerase
Deposited on 2000-12-18, released 2001-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU8
      • conflict (92-94)
      • conflict (110)
    Domains in SCOPe 2.08: d1hqma_
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU8
      • conflict (92-94)
      • conflict (110)
    Domains in SCOPe 2.08: d1hqmb_
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hqmc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU6 (Start-154)
      • conflict (118)
    • PDB 1HQM
    • Uniprot Q9KWU6 (191-End)
      • conflict (602)
      • conflict (605)
      • conflict (615)
      • insertion (686)
      • conflict (749)
      • conflict (856)
      • conflict (1128)
    Domains in SCOPe 2.08: d1hqmd_
  • Chain 'E':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hqme_
  • Heterogens: MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqmA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadve
    imnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqv
    edtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevskg
    ekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigersleei
    rqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqmA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveimnpd
    lhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtrl
    gqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hqmB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadve
    imnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqv
    edtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevskg
    ekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigersleei
    rqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqmB (B:)
    esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvl
    hefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveim
    npdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqved
    trlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hqmC (C:)
    mkikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
    seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
    kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
    eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqmC (C:)
    kikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkgk
    gglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplm
    tedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgv
    vtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlftl
    lrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkde
    vflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermvm
    gspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltre
    ragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvte
    evvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvfs
    lntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedg
    evvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpase
    egflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperi
    trdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgeka
    rdvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklanr
    hgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryi
    spvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspeeq
    lkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqplg
    gkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsvp
    esfrvlvkelqalaldvqtldekdnpvdifegl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hqmD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlfa
    teleqvlyfnkyivldpkgavldgvpvekrqlltdxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxidarmgaeaiqellkeldleklerelleemkhpsrarrakarkrlevvr
    afldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndlyrrlinrnnrlkkllaq
    gapeiiirnekrmlqeavdavidngrrgspvtnpgserplrsltdilsgkqgrfrqnllg
    krvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeekafapnvkaarrmlerq
    rdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegqsiqlhplvceafnadf
    dgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrdiilglyyitqvrkekk
    gagmafatpeealaayergevalnapivvagretsvgrlkfvfanpdeallavahglldl
    qdtvttrylgrrletnpgrilfarivgeavgdekvaqeliqmdvpqeknslkdlvyqafl
    rlgmektarlldalkyygftlsttsgiitigiddavipeekqryleeadrklrqieqaye
    mgfltdrerydqviqlwtettekvtqavfnnfeenypfnplyvmaqsgargnpqqirqlc
    gmrglmqkpsgetfevpvrssfregltvleyfisshgarkggadtalrtadsgyltrklv
    dvaheivvreadcgttkyisvplfqmdevtrtlrlrkrsdiesglygrvlarevealgrr
    leegrylsledvhflikaaeagevrevpvrspltcqtrygvcqkcygydlsmarpvsige
    avgvvaaesigepgtqltmrtfhtggvavgtditqglprvielfearrpkakaviseidg
    vvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidphqlleak
    gpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdspllegqvlekwd
    vealnerliaegkvpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdel
    iglkenvilgrlipagtgsdfvrftqvvdqrtlkaieearkeaveakekeaprrpvrreq
    pgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqmD (D:)
    kevrkvrialaspekirswsygevekpetegkvcercgvevtrsivrryrmghielatpa
    ahiwfvkdvpskigtlldlfateleqvlyfnkyivldpkgavldgvpvekrqlltdxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxidarmgaeaiqellkeldleklerelle
    emkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdatsdlndlyrrlinrn
    nrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrsltdilsgkq
    grfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeekafapnvk
    aarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegqsiqlhpl
    vceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrdiilglyy
    itqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfvfanpdeall
    avahglldlqdtvttrylgrrletnpgrilfarivgeavgdekvaqeliqmdvpqeknsl
    kdlvyqaflrlgmektarlldalkyygftlsttsgiitigiddavipeekqryleeadrk
    lrqieqayemgfltdrerydqviqlwtettekvtqavfnnfeenypfnplyvmaqsgarg
    npqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkggadtalrtad
    sgyltrklvdvaheivvreadcgttkyisvplfqmdevtrtlrlrkrsdiesglygrvla
    revealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcqkcygydls
    marpvsigeavgvvaaesigepgtqltmrtgtditqglprvielfearrpkakaviseid
    gvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidphqllea
    kgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdspllegqvlekw
    dvealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdelig
    lkenvilgrlipagtgsdfvrftqvvdqrtlkaie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hqmE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqmE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteee