PDB entry 1hql

View 1hql on RCSB PDB site
Description: The xenograft antigen in complex with the B4 isolectin of Griffonia simplicifolia lectin-1
Class: sugar binding protein
Keywords: Griffonia simplicifolia, lectin, xenograft antigen
Deposited on 2000-12-18, released 2002-01-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Griffonia simplicifolia
    Domains in SCOP 1.73: d1hqla_
  • Chain 'B':
    Compound: lectin
    Species: Griffonia simplicifolia
    Domains in SCOP 1.73: d1hqlb_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqlA (A:)
    esdsvsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvql
    wdnktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqps
    knqvvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgs
    aeiltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnlq
    stsvkaamepeitrtvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqlA (A:)
    svsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvqlwdn
    ktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqpsknq
    vvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgsaei
    ltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hqlB (B:)
    esdsvsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvql
    wdnktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqps
    knqvvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgs
    aeiltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnlq
    stsvkaamepeitrtvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqlB (B:)
    svsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvqlwdn
    ktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqpsknq
    vvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgsaei
    ltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnl