PDB entry 1hqb

View 1hqb on RCSB PDB site
Description: tertiary structure of apo-d-alanyl carrier protein
Class: transport protein
Keywords: 3-helix bundle
Deposited on 2000-12-14, released 2001-08-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apo-d-alanyl carrier protein
  Species: Lactobacillus casei
  Gene: DLTC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55153 (0-79)
  Domains in SCOP 1.75: d1hqba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hqbA (A:)
  adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
  fdrkewdtpnkiiakveqaq