PDB entry 1hqa

View 1hqa on RCSB PDB site
Description: alkaline phosphatase (h412q)
Class: hydrolase (alkaline phosphatase)
Keywords: hydrolase, phosphoric monoester, transferase, phospho, alcohol acceptor, hydrolase (alkaline phosphatase)
Deposited on 1995-11-30, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.161
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • engineered (411)
    Domains in SCOPe 2.07: d1hqaa_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-448)
      • engineered (411)
    Domains in SCOPe 2.07: d1hqab_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hqaA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqeqtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqaA (A:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqeqtgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hqaB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqeqtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hqaB (B:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqeqtgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk