PDB entry 1hq8

View 1hq8 on RCSB PDB site
Description: crystal structure of the murine nk cell-activating receptor nkg2d at 1.95 a
Class: apoptosis
Keywords: homodimer, cis-proline, APOPTOSIS
Deposited on 2000-12-14, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.215
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nkg2-d
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O54709 (0-122)
  Domains in SCOPe 2.07: d1hq8a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hq8A (A:)
  gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
  wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
  rav