PDB entry 1hq4

View 1hq4 on RCSB PDB site
Description:
Deposited on 2000-12-14, released 2003-06-03
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hq4a1, d1hq4a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hq4b1, d1hq4b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hq4c1, d1hq4c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1hq4d1, d1hq4d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq4A (A:)
    divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelkradvaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hq4B (B:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hq4B (B:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq4C (C:)
    divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelkradvaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hq4D (D:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hq4D (D:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepk