PDB entry 1hq3

View 1hq3 on RCSB PDB site
Description: crystal structure of the histone-core-octamer in kcl/phosphate
Deposited on 2000-12-14, released 2001-01-24
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hq3a_
  • Chain 'B':
    Domains in SCOP 1.57: d1hq3b_
  • Chain 'C':
    Domains in SCOP 1.57: d1hq3c_
  • Chain 'D':
    Domains in SCOP 1.57: d1hq3d_
  • Chain 'E':
    Domains in SCOP 1.57: d1hq3e_
  • Chain 'F':
    Domains in SCOP 1.57: d1hq3f_
  • Chain 'G':
    Domains in SCOP 1.57: d1hq3g_
  • Chain 'H':
    Domains in SCOP 1.57: d1hq3h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3A (A:)
    kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3B (B:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3C (C:)
    yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl
    vglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3D (D:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3E (E:)
    aksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3F (F:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3G (G:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq3H (H:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg