PDB entry 1hq1

View 1hq1 on RCSB PDB site
Description: structural and energetic analysis of RNA recognition by a universally conserved protein from the signal recognition particle
Class: signaling protein/RNA
Keywords: protein-RNA complex, double helix, tetraloop, internal loop, signal recognition particle, srp, ribonucleoprotein, signaling protein/RNA complex
Deposited on 2000-12-13, released 2001-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.156
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07019 (0-End)
      • engineered (78)
    Domains in SCOPe 2.07: d1hq1a_
  • Chain 'B':
    Compound: 4.5s RNA domain IV
  • Heterogens: MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hq1A (A:)
    gfdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmke
    rakpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hq1A (A:)
    gfdlndfleqlrqddkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnr
    llkqfddmqrmmkkmk
    

  • Chain 'B':
    No sequence available.