PDB entry 1hpw

View 1hpw on RCSB PDB site
Description: structure of a pilin monomer from pseudomonas aeruginosa: implications for the assembly of pili.
Class: contractile protein
Keywords: fimbria, methylation, CONTRACTILE PROTEIN
Deposited on 2000-12-13, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17838 (7-128)
      • see remark 999 (0-6)
      • see remark 999 (14)
    Domains in SCOPe 2.06: d1hpwa1, d1hpwa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hpwA (A:)
    alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
    ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
    cqtattttp