PDB entry 1hpw

View 1hpw on RCSB PDB site
Description: structure of a pilin monomer from pseudomonas aeruginosa: implications for the assembly of pili.
Deposited on 2000-12-13, released 2001-05-02
The last revision prior to the SCOP 1.71 freeze date was dated 2001-07-04, with a file datestamp of 2001-07-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1hpwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hpwA (A:)
  alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
  ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
  cqtattttp