PDB entry 1hpt

View 1hpt on RCSB PDB site
Description: three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1992-03-27, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic secretory trypsin inhibitor (kazal type) variant 3
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00995 (0-55)
      • conflict (17-18)
      • conflict (20)
      • conflict (28)
    Domains in SCOP 1.75: d1hpta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hptA (A:)
    dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc