PDB entry 1hpl

View 1hpl on RCSB PDB site
Description: horse pancreatic lipase. the crystal structure at 2.3 angstroms resolution
Deposited on 1993-01-27, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.159
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hplA (A:)
    nevcyerlgcfsddspwagiverplkilpwspekvntrfllytnenpdnfqeivadpsti
    qssnfntgrktrfiihgfidkgeeswlstmcqnmfkvesvncicvdwksgsrtaysqasq
    nvrivgaevaylvgvlqssfdyspsnvhiighslgshaageagrrtngavgritgldpae
    pcfqgtpelvrldpsdaqfvdvihtdiapfipnlgfgmsqtaghldffpnggkempgcqk
    nvlsqivdidgiwqgtrdfaacnhlrsykyytdsilnpdgfagfscasysdftankcfpc
    ssegcpqmghyadrfpgrtkgvgqlfylntgdasnfarwryrvdvtlsgkkvtghvlvsl
    fgnkgnsrqyeifqgtlkpdntysnefdsdvevgdlekvkfiwynnvinltlpkvgaski
    tverndgsvfnfcseetvredvlltltac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hplA (A:)
    nevcyerlgcfsddspwagiverplkilpwpekvntrfllytnenpdnfqeivadpstiq
    ssnfntgrktrfiihgfidkgeeswlstmcqnmfkvesvncicvdwksgsrtaysqasqn
    vrivgaevaylvgvlqssfdyspsnvhiighslgshaageagrrtngavgritgldpaep
    cfqgtpelvrldpsdaqfvdvihtdiapfipnlgfgmsqtaghldffpnggkempgcqkn
    vlsqivdidgiwqgtrdfaacnhlrsykyytdsilnpdgfagfscasysdftankcfpcs
    segcpqmghyadrfpgrtkgvgqlfylntgdasnfarwryrvdvtlsgkkvtghvlvslf
    gnkgnsrqyeifqgtlkpdntysnefdsdvevgdlekvkfiwynnvinltlpkvgaskit
    verndgsvfnfcseetvredvlltltac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hplB (B:)
    nevcyerlgcfsddspwagiverplkilpwspekvntrfllytnenpdnfqeivadpsti
    qssnfntgrktrfiihgfidkgeeswlstmcqnmfkvesvncicvdwksgsrtaysqasq
    nvrivgaevaylvgvlqssfdyspsnvhiighslgshaageagrrtngavgritgldpae
    pcfqgtpelvrldpsdaqfvdvihtdiapfipnlgfgmsqtaghldffpnggkempgcqk
    nvlsqivdidgiwqgtrdfaacnhlrsykyytdsilnpdgfagfscasysdftankcfpc
    ssegcpqmghyadrfpgrtkgvgqlfylntgdasnfarwryrvdvtlsgkkvtghvlvsl
    fgnkgnsrqyeifqgtlkpdntysnefdsdvevgdlekvkfiwynnvinltlpkvgaski
    tverndgsvfnfcseetvredvlltltac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hplB (B:)
    nevcyerlgcfsddspwagiverplkilpwpekvntrfllytnenpdnfqeivadpstiq
    ssnfntgrktrfiihgfidkgeeswlstmcqnmfkvesvncicvdwksgsrtaysqasqn
    vrivgaevaylvgvlqssfdyspsnvhiighslgshaageagrrtngavgritgldpaep
    cfqgtpelvrldpsdaqfvdvihtdiapfipnlgfgmsqtaghldffpnggkempgcqkn
    vlsqivdidgiwqgtrdfaacnhlrsykyytdsilnpdgfagfscasysdftankcfpcs
    segcpqmghyadrfpgrtkgvgqlfylntgdasnfarwryrvdvtlsgkkvtghvlvslf
    gnkgnsrqyeifqgtlkpdntysnefdsdvevgdlekvkfiwynnvinltlpkvgaskit
    verndgsvfnfcseetvredvlltltac