PDB entry 1hpk

View 1hpk on RCSB PDB site
Description: solution nmr structure of the human plasminogen kringle 1 domain complexed with 6-aminohexanoic acid at ph 5.3, 310k, derived from randomly generated structures using simulated annealing, minimized average structure
Deposited on 1996-08-14, released 1997-03-12
The last revision prior to the SCOP 1.69 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1hpk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hpk_ (-)
    cktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqgp
    wcyttdpekrydycdilec