PDB entry 1hpk

View 1hpk on RCSB PDB site
Description: solution nmr structure of the human plasminogen kringle 1 domain complexed with 6-aminohexanoic acid at ph 5.3, 310k, derived from randomly generated structures using simulated annealing, minimized average structure
Class: serine protease
Keywords: serine protease, fibrinolytic enzyme, lysine-binding domain
Deposited on 1996-08-14, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plasminogen
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00747 (0-78)
  Domains in SCOPe 2.08: d1hpka_
• Heterogens: ACA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hpkA (A:)
  cktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqgp
  wcyttdpekrydycdilec