PDB entry 1hpi

View 1hpi on RCSB PDB site
Description: molecular structure of the oxidized high-potential iron-sulfur protein isolated from ectothiorhodospira vacuolata
Deposited on 1993-12-09, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1hpi__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hpi_ (-)
  merlseddpaaqaleyrhdassvqhpayeegqtclncllytdasaqdwgpcsvfpgklvs
  angwctawvar