PDB entry 1hph

View 1hph on RCSB PDB site
Description: structure of human parathyroid hormone 1-37 in solution
Class: hormone
Keywords: hormone
Deposited on 1995-02-14, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human parathyroid hormone fragment 1 - 37
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hpha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hphA (A:)
    svseiqlmhnlgkhlnsmervewlrkklqdvhnfval