PDB entry 1hpb

View 1hpb on RCSB PDB site
Description: the bacterial periplasmic histidine-binding protein: structure(slash)function analysis of the ligand-binding site and comparison with related proteins
Class: histidine-binding protein
Keywords: histidine-binding protein
Deposited on 1993-09-30, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'P':
  Compound: histidine-binding protein
  Species: Salmonella typhimurium [TaxId:602]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02910 (0-237)
  Domains in SCOPe 2.08: d1hpbp_
• Heterogens: HIS

PDB Chain Sequences:

• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hpbP (P:)
  aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
  akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
  tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
  ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg