PDB entry 1hp5

View 1hp5 on RCSB PDB site
Description: streptomyces plicatus beta-n-acetylhexosaminidase complexed with intermediate analouge nag-thiazoline
Class: hydrolase
Keywords: glycosyl hydrolase, streptomyces plicatus, hexosaminidase, family 20, substrate assisted catalysis, TIM barrel, HYDROLASE
Deposited on 2000-12-12, released 2001-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-n-acetylhexosaminidase
    Species: Streptomyces plicatus [TaxId:1922]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hp5a1, d1hp5a2
  • Heterogens: CL, SO4, NGT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hp5A (A:)
    mhhhhhhhtgaapdrkapvrptpldrvipapasvdpggapyritrgthirvddsrearrv
    gdyladllrpatgyrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglf
    hgvqtlrqllppavekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryi
    drvarykynklhlhlsddqgwriaidswprlatyggstevgggpggyytkaeykeivrya
    asrhlevvpeidmpghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvdd
    vigelaaltpgrylhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepve
    galvqywgldrtgdaekaevaeaarngtglilspadrtyldmkytkdtplglswagyvev
    qrsydwdpagylpgapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasth
    dwdtykvrlaaqapyweaagidfyrspqvpwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hp5A (A:)
    drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
    yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
    vekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryidrvarykynklhl
    hlsddqgwriaidswprlatyggstevgggpggyytkaeykeivryaasrhlevvpeidm
    pghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvddvigelaaltpgry
    lhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepvegalvqywgldrtg
    daekaevaeaarngtglilspadrtyldmkytkdtplglswagyvevqrsydwdpagylp
    gapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasthdwdtykvrlaaqa
    pyweaagidfyrspqvpwt