PDB entry 1hp4

View 1hp4 on RCSB PDB site
Description: crystal structure of streptomyces plicatus beta-n-acetylhexosaminidase
Class: hydrolase
Keywords: glycosyl hydrolase, hexosaminidase, Streptomyces plicatus, family 20, X-ray, TIM barrel
Deposited on 2000-12-12, released 2001-04-04
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-n-acetylhexosaminidase
    Species: Streptomyces plicatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hp4a1, d1hp4a2
  • Heterogens: CL, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hp4A (A:)
    mhhhhhhhtgaapdrkapvrptpldrvipapasvdpggapyritrgthirvddsrearrv
    gdyladllrpatgyrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglf
    hgvqtlrqllppavekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryi
    drvarykynklhlhlsddqgwriaidswprlatyggstevgggpggyytkaeykeivrya
    asrhlevvpeidmpghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvdd
    vigelaaltpgrylhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepve
    galvqywgldrtgdaekaevaeaarngtglilspadrtyldmkytkdtplglswagyvev
    qrsydwdpagylpgapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasth
    dwdtykvrlaaqapyweaagidfyrspqvpwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hp4A (A:)
    drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
    yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
    vekdsaqpgpwlvaggtiedtpryawrsamldvsrhffgvdevkryidrvarykynklhl
    hlsddqgwriaidswprlatyggstevgggpggyytkaeykeivryaasrhlevvpeidm
    pghtnaalasyaelncdgvapplytgtkvgfsslcvdkdvtydfvddvigelaaltpgry
    lhiggdeahstpkadfvafmkrvqpivakygktvvgwhqlagaepvegalvqywgldrtg
    daekaevaeaarngtglilspadrtyldmkytkdtplglswagyvevqrsydwdpagylp
    gapadavrgveaplwtetlsdpdqldymafprlpgvaelgwspasthdwdtykvrlaaqa
    pyweaagidfyrspqvpwt