PDB entry 1hoz

View 1hoz on RCSB PDB site
Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax
Class: hydrolase
Keywords: Rossmann-fold-like motif, HYDROLASE
Deposited on 2000-12-12, released 2001-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine-adenosine-guanosine-preferring nucleoside hydrolase
    Species: Trypanosoma vivax [TaxId:5699]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GPQ4 (13-338)
      • expression tag (11-12)
      • see remark 999 (312)
    Domains in SCOPe 2.06: d1hoza1, d1hoza2
  • Chain 'B':
    Compound: inosine-adenosine-guanosine-preferring nucleoside hydrolase
    Species: Trypanosoma vivax [TaxId:5699]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GPQ4 (13-338)
      • expression tag (12)
      • see remark 999 (312)
    Domains in SCOPe 2.06: d1hozb1, d1hozb2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hozA (A:)
    mrgsphhhhhhgsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfn
    vtgkimclmhnnmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdki
    kaenekyegqqlladlvmnseekvticvtgplsnvawcidkygekftskveecvimggav
    dvrgnvflpstdgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfge
    qtnfllsilvgtmwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkq
    pnegatvrtdaenypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hozA (A:)
    gsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhn
    nmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqq
    lladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpst
    dgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvg
    tmwamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnp
    eaeffldmllrsarac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hozB (B:)
    mrgsphhhhhhgsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfn
    vtgkimclmhnnmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdki
    kaenekyegqqlladlvmnseekvticvtgplsnvawcidkygekftskveecvimggav
    dvrgnvflpstdgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfge
    qtnfllsilvgtmwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkq
    pnegatvrtdaenypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hozB (B:)
    saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
    mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
    ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
    gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
    mwamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpe
    aeffldmllrsarac