PDB entry 1hoz

View 1hoz on RCSB PDB site
Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax
Deposited on 2000-12-12, released 2001-12-12
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hoza_
  • Chain 'B':
    Domains in SCOP 1.59: d1hozb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hozA (A:)
    gsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhn
    nmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqq
    lladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpst
    dgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvg
    tmwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtda
    enypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hozA (A:)
    gsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhn
    nmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqq
    lladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpst
    dgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvg
    tmwamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnp
    eaeffldmllrsarac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hozB (B:)
    saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
    mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
    ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
    gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
    mwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdae
    nypltfvarnpeaeffldmllrsarac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hozB (B:)
    saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
    mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
    ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
    gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
    mwamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpe
    aeffldmllrsarac