PDB entry 1hoy

View 1hoy on RCSB PDB site
Description: nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Deposited on 2000-12-12, released 2000-12-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hoya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hoyA (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg